Best face syrum in Pakistan | rivaj UK vitamin c syrum | how to use syrum for best results.
I have told all the steps to apply a syrum and do and don’t of syrum.
About my youtube channel:
Hi I am Huma Tahir and welcome to my YouTube channel . This YouTube channel relates to a women’s life, as she cooks, she care for herself, she dresses herself well, she loves to shop. Women of this century is updated with fashion, social issues, style that suits her and latest trends in every field. She deals with all ups and downs flawlessly. If she know how to deal with latest trends , she also knows to do DIY to maintain her budget. She is actually all in one…A beautition, A cook, A working women, A skin specialist, A self experienced doctor, an economist as well a social influencers. So this YouTube channel relates to all fields as a women deals all of these.#HumaTahir #remedieswithhumatahir#humatahir
#easybeautyremedies
Some of our video’s
Dermacos facial kit review
Dermoteen whitening cream and face wash review
Merium pervaiz homemade tint
Ctm for acne prone skin #skincare
How to remove acne with one ingredient
Hair mask for shiny thick and silky smooth hair
How to grow long and thicken hair faster
Merium pervaiz summer skin care mask review
DIY natural hair protein treatment for hair growth
Hira mani photo shoot with her husband mani
Mahira khan in loreal Paris fashion week 2019
Justice for Nimrita kumari
Abid ali has passed away
Aimankhan and muneeb butt good news for a baby
Imad wasim and his wife dance video on his wedding
Naimal khawar with her family
Hamza ali abbasi and naimal khawar walima pictures
Hamza ali abbasi wedding pictures and videos full HD
DIY hair oil for amazingly growing hair
Our social links:
Follow me on Instagram
Follow me on facebook
Follow me on Tiktok
@humatahir57
*Disclaimer *:the information provided on this channel is only for general purposes and should not be taken as professional advice. We are not licensed professional. All the information provided on this channel is my own opinion.
#tighteningmask #dermacosskintighteningclaymask #gettighteskin #howtogetyoungskin #skin tightening mask, clay mask, whitening mask #dermacos #dermacosscrub #dermacoscleanser#claytighteningmask #tighteningmaskforface #tighteningmaskintelgu, tighteningmaskintamil# tightening #agetighteningmask #dermacosskintighteningclaymaskreviewinurduhindi #dermacosfacialkit #MuskuratiMorning #TVOne #fitness #makeuptutorial #food #makeupaddict #beauty #paktotkay #naturalremedies #homeremedies #totkay #totka #skinwhitening #skinbrightening #hair removal #facepacks #naziamalikmakeuptutorial #beautyvlogs #howtoapplybase #facecontouring #eyemakeup #smokeyeyeskesebanaye #applymakeuplikeapro #gorarangkarnekaformula #homemademakeuptutorial #acnetreatment #motapekailaj #weightlosstreatment #howtomakebigeyebrows #party makeup
